Recombinant Human B3GNT7 protein, GST-tagged

Cat.No. : B3GNT7-025H
Product Overview : Human B3GNT7 full-length ORF ( AAI48681.1, 1 a.a. - 401 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 71.06 kDa
AA Sequence : MSLWKKTVYRSLCLALALLVAVTVFQRSLTPGQFLQEPPPPTLEPQKAQKPNGQLVNPNNFWKNPKDVAAPTPMASQGPQAWDVTTTNCSANINLTHQPWFQVLEPQFRQFLFYRHCRYFPMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWGRERQSAGGGRGAVRTLFLLGTASKQEERTHYQQLLAYEDRLYGDILQWGFLDTFFNLTLKEIHFLKWLDIYCPHVPFIFKGDDDVFVNPTNLLEFLADRQPQENLFVGDVLQHARPIRRKDNKYYIPGALYGKASYPPYAGGGGFLMAGSLARRLHHACDTLELYPIDDVFLGMCLEVLGVQPTAHEGFKTFGISRNRNSRMNKEPCFFRAMLVVHKLLPPELLAMWGLVHSNLTCSRKLQVL
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name B3GNT7 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 [ Homo sapiens ]
Official Symbol B3GNT7
Synonyms 3-Gn-T7; 3-N-acetylglucosaminyltransferase 7; B3GN7_HUMAN; B3gnt7; Beta 1 3 N acetylglucosaminyltransferase 7; Beta-1; Beta3Gn T7; Beta3Gn-T7; beta3GnT7; BGnT 7; BGnT-7; UDP GlcNAc betaGal beta 1 3 N acetylglucosaminyltransferase 7; UDP-GlcNAc:betaGal beta-1; B3GNT7
Gene ID 93010
mRNA Refseq NM_145236.2
Protein Refseq NP_660279.1
UniProt ID Q8NFL0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All B3GNT7 Products

Required fields are marked with *

My Review for All B3GNT7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon