Recombinant Human B3GNT7 protein, GST-tagged
Cat.No. : | B3GNT7-025H |
Product Overview : | Human B3GNT7 full-length ORF ( AAI48681.1, 1 a.a. - 401 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 71.06 kDa |
AA Sequence : | MSLWKKTVYRSLCLALALLVAVTVFQRSLTPGQFLQEPPPPTLEPQKAQKPNGQLVNPNNFWKNPKDVAAPTPMASQGPQAWDVTTTNCSANINLTHQPWFQVLEPQFRQFLFYRHCRYFPMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWGRERQSAGGGRGAVRTLFLLGTASKQEERTHYQQLLAYEDRLYGDILQWGFLDTFFNLTLKEIHFLKWLDIYCPHVPFIFKGDDDVFVNPTNLLEFLADRQPQENLFVGDVLQHARPIRRKDNKYYIPGALYGKASYPPYAGGGGFLMAGSLARRLHHACDTLELYPIDDVFLGMCLEVLGVQPTAHEGFKTFGISRNRNSRMNKEPCFFRAMLVVHKLLPPELLAMWGLVHSNLTCSRKLQVL |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | B3GNT7 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 [ Homo sapiens ] |
Official Symbol | B3GNT7 |
Synonyms | 3-Gn-T7; 3-N-acetylglucosaminyltransferase 7; B3GN7_HUMAN; B3gnt7; Beta 1 3 N acetylglucosaminyltransferase 7; Beta-1; Beta3Gn T7; Beta3Gn-T7; beta3GnT7; BGnT 7; BGnT-7; UDP GlcNAc betaGal beta 1 3 N acetylglucosaminyltransferase 7; UDP-GlcNAc:betaGal beta-1; B3GNT7 |
Gene ID | 93010 |
mRNA Refseq | NM_145236.2 |
Protein Refseq | NP_660279.1 |
UniProt ID | Q8NFL0 |
◆ Recombinant Proteins | ||
B3GNT7-576R | Recombinant Rat B3GNT7 Protein, His (Fc)-Avi-tagged | +Inquiry |
B3GNT7-1638HF | Recombinant Full Length Human B3GNT7 Protein, GST-tagged | +Inquiry |
B3GNT7-2245M | Recombinant Mouse B3GNT7 Protein | +Inquiry |
B3GNT7-918R | Recombinant Rat B3GNT7 Protein | +Inquiry |
B3GNT7-11442Z | Recombinant Zebrafish B3GNT7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
B3GNT7-2109HCL | Recombinant Human B3GNT7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All B3GNT7 Products
Required fields are marked with *
My Review for All B3GNT7 Products
Required fields are marked with *
0
Inquiry Basket