Recombinant Human B3GAT1 protein, GST-tagged
Cat.No. : | B3GAT1-014H |
Product Overview : | Human B3GAT1 partial ORF ( NP_061114, 235 a.a. - 332 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the glucuronyltransferase gene family. These enzymes exhibit strict acceptor specificity, recognizing nonreducing terminal sugars and their anomeric linkages. This gene product functions as the key enzyme in a glucuronyl transfer reaction during the biosynthesis of the carbohydrate epitope HNK-1 (human natural killer-1, also known as CD57 and LEU7). Alternate transcriptional splice variants have been characterized. [provided by RefSeq] |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.52 kDa |
AA Sequence : | AGKVVRWKTVFDPHRPFAIDMAGFAVNLRLILQRSQAYFKLRGVKGGYQESSLLRELVTLNDLEPKAANCTKILVWHTRTEKPVLVNEGKKGFTDPSV |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | B3GAT1 beta-1,3-glucuronyltransferase 1 (glucuronosyltransferase P) [ Homo sapiens ] |
Official Symbol | B3GAT1 |
Synonyms | B3GAT1; beta-1,3-glucuronyltransferase 1 (glucuronosyltransferase P); CD57, CD57 antigen , LEU7; galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1; GlcAT P; HNK 1; NK 1; glcUAT-P; LEU7 antigen; glucuronosyltransferase P; UDP-GlcUA:glycoprotein beta-1,3-glucuronyltransferase; NK1; CD57; HNK1; LEU7; NK-1; GLCATP; GLCUATP; |
Gene ID | 27087 |
mRNA Refseq | NM_018644 |
Protein Refseq | NP_061114 |
MIM | 151290 |
UniProt ID | Q9P2W7 |
◆ Recombinant Proteins | ||
B3GAT1-915R | Recombinant Rat B3GAT1 Protein | +Inquiry |
B3GAT1-5191C | Recombinant Chicken B3GAT1 | +Inquiry |
B3GAT1-4195H | Recombinant Human B3GAT1 Protein (Thr28-Ile334), C-His tagged | +Inquiry |
B3GAT1-015H | Recombinant Human B3GAT1 protein, GST-tagged | +Inquiry |
B3gat1-571R | Recombinant Rat B3gat1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
B3GAT1-8546HCL | Recombinant Human B3GAT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All B3GAT1 Products
Required fields are marked with *
My Review for All B3GAT1 Products
Required fields are marked with *
0
Inquiry Basket