Recombinant Human B3GAT1 protein, GST-tagged

• Cat.No.: B3GAT1-014H
• Product Overview: Human B3GAT1 partial ORF ( NP_061114, 235 a.a. - 332 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a member of the glucuronyltransferase gene family. These enzymes exhibit strict acceptor specificity, recognizing nonreducing terminal sugars and their anomeric linkages. This gene product functions as the key enzyme in a glucuronyl transfer reaction during the biosynthesis of the carbohydrate epitope HNK-1 (human natural killer-1, also known as CD57 and LEU7). Alternate transcriptional splice variants have been characterized. [provided by RefSeq]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.52 kDa
• AA Sequence: AGKVVRWKTVFDPHRPFAIDMAGFAVNLRLILQRSQAYFKLRGVKGGYQESSLLRELVTLNDLEPKAANCTKILVWHTRTEKPVLVNEGKKGFTDPSV
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: B3GAT1 beta-1,3-glucuronyltransferase 1 (glucuronosyltransferase P) [ Homo sapiens ]
• Official Symbol: B3GAT1
• Synonyms: B3GAT1; beta-1,3-glucuronyltransferase 1 (glucuronosyltransferase P); CD57, CD57 antigen , LEU7; galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1; GlcAT P; HNK 1; NK 1; glcUAT-P; LEU7 antigen; glucuronosyltransferase P; UDP-GlcUA:glycoprotein beta-1,3-glucuronyltransferase; NK1; CD57; HNK1; LEU7; NK-1; GLCATP; GLCUATP
• Gene ID: 27087
• mRNA Refseq: NM_018644
• Protein Refseq: NP_061114
• MIM: 151290
• UniProt ID: Q9P2W7