Recombinant Human B3GALT2 protein, GST-tagged

Cat.No. : B3GALT2-007H
Product Overview : Human B3GALT2 partial ORF ( NP_003774, 324 a.a. - 422 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. This family encodes type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and different acceptor sugars (N-acetylglucosamine, galactose, N-acetylgalactosamine). The beta3GalT genes are distantly related to the Drosophila Brainiac gene and have the protein coding sequence contained in a single exon. The beta3GalT proteins also contain conserved sequences not found in the beta4GalT or alpha3GalT proteins. The carbohydrate chains synthesized by these enzymes are designated as type 1, whereas beta4GalT enzymes synthesize type 2 carbohydrate chains. The ratio of type 1:type 2 chains changes during embryogenesis. By sequence similarity, the beta3GalT genes fall into at least two groups: beta3GalT4 and 4 other beta3GalT genes (beta3GalT1-3, beta3GalT5). This gene encodes a protein that functions in N-linked glycoprotein glycosylation and shows strict donor substrate specificity for UDP-galactose. [provided by RefSeq]
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.63 kDa
AA Sequence : AEKIFKVSLGIRRLHLEDVYVGICLAKLRIDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKHNACANAAKEKAGRYRHRKLH
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name B3GALT2 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 [ Homo sapiens ]
Official Symbol B3GALT2
Synonyms B3GALT2; UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2; beta-1,3-galactosyltransferase 2; beta3Gal T2; beta-3-galt2; beta-1,3-GalTase 2; UDP-galactose:2-acetamido-2-deoxy-D-glucose 3beta-galactosyltransferase 2; GLCT2; BETA3GALT2; beta3Gal-T2;
Gene ID 8707
mRNA Refseq NM_003783
Protein Refseq NP_003774
MIM 603018
UniProt ID O43825

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All B3GALT2 Products

Required fields are marked with *

My Review for All B3GALT2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon