Recombinant Human AWAT1 Protein, GST-tagged

• Cat.No.: AWAT1-5231H
• Product Overview: Human DGAT2L3 full-length ORF ( AAI53035.1, 1 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene belongs to the diacylglycerol acyltransferase family. It esterifies long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that this enzyme plays a central role in lipid metabolism in skin. Consistent with this observation, this protein is predominantly expressed in the sebaceous gland of the skin. [provided by RefSeq, Sep 2009]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 63.03 kDa
• AA Sequence: MAHSKQPSHFQSLMLLQWPLSYLAIFWILQPLFVYLLFTSLWPLPVLYFAWLFLDWKTPERGGRRSAWVRNWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEATGFSKTFPGITPHLATLSWFFKIPFVREYLMAKGVCSVSQPAINYLLSHGTGNLVGIVVGGVGEALQSVPNTTTLILQKRKGFVRTALQHGAHLVPTFTFGETEVYDQVLFHKDSRMYKFQSCFRRIFGFYCCVFYGQSFCQGSTGLLPYSRPIVTVVGEPLPLPQIEKPSQEMVDKYHALYMDALHKLFDQHKTHYGCSETQKLFFL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AWAT1 acyl-CoA wax alcohol acyltransferase 1 [ Homo sapiens (human) ]
• Official Symbol: AWAT1
• Synonyms: DGAT2L3; AWAT1; acyl-CoA wax alcohol acyltransferase 1; DGA2; acyl-CoA wax alcohol acyltransferase 1; diacyl-glycerol acyltransferase 2; diacylglycerol O-acyltransferase 2-like 3; diacylglycerol O-acyltransferase 2-like protein 3; diacylglycerol acyltransferase 2; long-chain-alcohol O-fatty-acyltransferase 1; EC 2.3.1.75
• Gene ID: 158833
• mRNA Refseq: NM_001013579
• Protein Refseq: NP_001013597
• MIM: 300924
• UniProt ID: Q58HT5