Recombinant Human AURKA protein, His-tagged

• Cat.No.: AURKA-3176H
• Product Overview: Recombinant Human AURKA protein(1-132 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-132 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MDRSKENCISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRVPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKNEESKKRQWALED
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: AURKA aurora kinase A [ Homo sapiens ]
• Official Symbol: AURKA
• Synonyms: AURKA; aurora kinase A; serine/threonine kinase 6 , serine/threonine kinase 15 , STK6, STK15; ARK1; AurA; BTAK; PPP1R47; protein phosphatase 1; regulatory subunit 47; STK7; ARK-1; hARK1; aurora 2; IPL1-related kinase; aurora-related kinase 1; aurora/IPL1-like kinase; serine/threonine kinase 6; aurora/IPL1-related kinase 1; breast tumor-amplified kinase; breast-tumor-amplified kinase; serine/threonine-protein kinase 6; serine/threonine protein kinase 15; serine/threonine-protein kinase 15; serine/threonine-protein kinase aurora-A; protein phosphatase 1, regulatory subunit 47; AIK; AURA; STK6; STK15; AURORA2; MGC34538
• Gene ID: 6790
• mRNA Refseq: NM_003600
• Protein Refseq: NP_003591
• MIM: 603072
• UniProt ID: O14965