Recombinant Human ATPBD4 protein, GST-tagged
Cat.No. : | ATPBD4-1024H |
Product Overview : | Human ATPBD4 full-length ORF ( NP_542381.1, 1 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DPH6 (Diphthamine Biosynthesis 6) is a Protein Coding gene. Among its related pathways are Metabolism of proteins and Gamma carboxylation, hypusine formation and arylsulfatase activation. GO annotations related to this gene include diphthine-ammonia ligase activity. |
Molecular Mass : | 56.7 kDa |
AA Sequence : | MRVAALISGGKDSCYNMMQCIAAGHQIVALANLRPAENQVGSDELDSYMYQTVGHHAIDLYAEAMALPLYRRTIRGRSLDTRQVYTKCEGDEVEDLYELLKLVKEKEEVEGISVGAILSDYQRIRVENVCKRLNLQPLAYLWQRNQEDLLREMISSNIQAMIIKVAALGLDPDKHLGKTLDQMEPYLIELSKKYGVHVCGEGGEYETFTLDCPLFKKKIIVDSSEVVIHSADAFAPVAYLRFLELHLEDKVSSVPDNYRTSNYIYNF |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATPBD4 ATP binding domain 4 [ Homo sapiens ] |
Official Symbol | ATPBD4 |
Synonyms | DPH6; diphthamine biosynthesis 6; ATPBD4; diphthine--ammonia ligase; ATP binding domain 4; ATP-binding domain-containing protein 4; DPH6 homolog; diphthamide synthase; diphthamide synthetase; protein DPH6 homolog; EC 6.3.1.14 |
Gene ID | 89978 |
mRNA Refseq | NM_080650.3 |
Protein Refseq | NP_542381.1 |
UniProt ID | Q7L8W6 |
◆ Recombinant Proteins | ||
ATPBD4-897R | Recombinant Rat ATPBD4 Protein | +Inquiry |
ATPBD4-474R | Recombinant Rhesus monkey ATPBD4 Protein, His-tagged | +Inquiry |
ATPBD4-2539H | Recombinant Human ATPBD4 protein, His-tagged | +Inquiry |
ATPBD4-553R | Recombinant Rat ATPBD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATPBD4-303R | Recombinant Rhesus Macaque ATPBD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATPBD4-8570HCL | Recombinant Human ATPBD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATPBD4 Products
Required fields are marked with *
My Review for All ATPBD4 Products
Required fields are marked with *
0
Inquiry Basket