Recombinant Human ATPBD4 protein, GST-tagged

• Cat.No.: ATPBD4-1024H
• Product Overview: Human ATPBD4 full-length ORF ( NP_542381.1, 1 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: DPH6 (Diphthamine Biosynthesis 6) is a Protein Coding gene. Among its related pathways are Metabolism of proteins and Gamma carboxylation, hypusine formation and arylsulfatase activation. GO annotations related to this gene include diphthine-ammonia ligase activity.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 56.7 kDa
• AA Sequence: MRVAALISGGKDSCYNMMQCIAAGHQIVALANLRPAENQVGSDELDSYMYQTVGHHAIDLYAEAMALPLYRRTIRGRSLDTRQVYTKCEGDEVEDLYELLKLVKEKEEVEGISVGAILSDYQRIRVENVCKRLNLQPLAYLWQRNQEDLLREMISSNIQAMIIKVAALGLDPDKHLGKTLDQMEPYLIELSKKYGVHVCGEGGEYETFTLDCPLFKKKIIVDSSEVVIHSADAFAPVAYLRFLELHLEDKVSSVPDNYRTSNYIYNF
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATPBD4 ATP binding domain 4 [ Homo sapiens ]
• Official Symbol: ATPBD4
• Synonyms: DPH6; diphthamine biosynthesis 6; ATPBD4; diphthine--ammonia ligase; ATP binding domain 4; ATP-binding domain-containing protein 4; DPH6 homolog; diphthamide synthase; diphthamide synthetase; protein DPH6 homolog; EC 6.3.1.14
• Gene ID: 89978
• mRNA Refseq: NM_080650.3
• Protein Refseq: NP_542381.1
• UniProt ID: Q7L8W6