Recombinant Human ATP9B protein, GST-tagged

• Cat.No.: ATP9B-1019H
• Product Overview: Human ATP9B full-length ORF ( AAH53561.1, 1 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ATP9B (ATPase Phospholipid Transporting 9B (Putative)) is a Protein Coding gene. Among its related pathways are Ion channel transport and Cardiac conduction. GO annotations related to this gene include nucleotide binding and cation-transporting ATPase activity. An important paralog of this gene is ATP9A.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 42.7 kDa
• AA Sequence: MPLMMSEEGFENEESDYHTLPRARIMQRKRGLEWFVCDGWKFLCTSCCGWLINICRRKKELKARTVWLGCPEKCEEKHPRNSIKNQKYNVFTFIPGVLYEQFKFFLNLYFLVISCSQFVPALKIGYLYTYWAPLMT
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATP9B ATPase phospholipid transporting 9B (putative) [ Homo sapiens (human) ]
• Official Symbol: ATP9B
• Synonyms: ATP9B; ATPase phospholipid transporting 9B (putative); NEO1L; hMMR1; ATPIIB; ATPASEP; HUSSY-20; probable phospholipid-transporting ATPase IIB; ATPase type IV, phospholipid transporting (P-type); ATPase, class II, type 9B; macrophage MHC receptor 1; EC 3.6.3.1
• Gene ID: 374868
• mRNA Refseq: NM_001306085
• Protein Refseq: NP_001293014
• MIM: 614446
• UniProt ID: O43861