Recombinant Human ATP9B protein, GST-tagged

Cat.No. : ATP9B-1019H
Product Overview : Human ATP9B full-length ORF ( AAH53561.1, 1 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ATP9B (ATPase Phospholipid Transporting 9B (Putative)) is a Protein Coding gene. Among its related pathways are Ion channel transport and Cardiac conduction. GO annotations related to this gene include nucleotide binding and cation-transporting ATPase activity. An important paralog of this gene is ATP9A.
Molecular Mass : 42.7 kDa
AA Sequence : MPLMMSEEGFENEESDYHTLPRARIMQRKRGLEWFVCDGWKFLCTSCCGWLINICRRKKELKARTVWLGCPEKCEEKHPRNSIKNQKYNVFTFIPGVLYEQFKFFLNLYFLVISCSQFVPALKIGYLYTYWAPLMT
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATP9B ATPase phospholipid transporting 9B (putative) [ Homo sapiens (human) ]
Official Symbol ATP9B
Synonyms ATP9B; ATPase phospholipid transporting 9B (putative); NEO1L; hMMR1; ATPIIB; ATPASEP; HUSSY-20; probable phospholipid-transporting ATPase IIB; ATPase type IV, phospholipid transporting (P-type); ATPase, class II, type 9B; macrophage MHC receptor 1; EC 3.6.3.1
Gene ID 374868
mRNA Refseq NM_001306085
Protein Refseq NP_001293014
MIM 614446
UniProt ID O43861

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ATP9B Products

Required fields are marked with *

My Review for All ATP9B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon