Recombinant Human ATP6V1G2 protein, GST-tagged
Cat.No. : | ATP6V1G2-1010H |
Product Overview : | Human ATP6V1G2 full-length ORF ( NP_569730.1, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of three V1 domain G subunit proteins. This gene had previous gene symbols of ATP6G and ATP6G2. Alternatively spliced transcript variants encoding different isoforms have been described. Read-through transcription also exists between this gene and the downstream DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B (DDX39B) gene. [provided by RefSeq, Feb 2011] |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 40 kDa |
AA Sequence : | MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRISA |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATP6V1G2 ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2 [ Homo sapiens ] |
Official Symbol | ATP6V1G2 |
Synonyms | ATP6V1G2; ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2; ATP6G, ATP6G2, ATPase, H+ transporting, lysosomal (vacuolar proton pump) , ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 2; V-type proton ATPase subunit G 2; Em:AC004181.3; NG38; Vma10; V-ATPase 13 kDa subunit 2; vacuolar proton pump G subunit 2; vacuolar ATP synthase subunit G 2; H(+)-transporting two-sector ATPase, subunit G2; ATPase, H+ transporting, lysosomal (vacuolar proton pump); ATP6G; VMA10; ATP6G2; |
Gene ID | 534 |
mRNA Refseq | NM_001204078 |
Protein Refseq | NP_001191007 |
MIM | 606853 |
UniProt ID | O95670 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ATP6V1G2 Products
Required fields are marked with *
My Review for All ATP6V1G2 Products
Required fields are marked with *
0
Inquiry Basket