Recombinant Human ATP5J2 Full Length Transmembrane protein, His-tagged

Cat.No. : ATP5J2-1298H
Product Overview : Recombinant Human ATP5J2 protein(P56134)(1-94aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-94aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 12.4 kDa
AA Sequence : MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name ATP5J2 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2 [ Homo sapiens ]
Official Symbol ATP5J2
Synonyms ATP5J2; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f, isoform 2 , ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F2; ATP synthase subunit f, mitochondrial; ATP synthase f chain; mitochondrial; ATP5JL; F1Fo ATP synthase complex Fo membrane domain f subunit; F1Fo ATPase; F1Fo ATPase synthase f subunit; F1F0-type ATPase subunit f; F1Fo-ATPase synthase f subunit; ATP synthase f chain, mitochondrial; F1Fo-ATP synthase complex Fo membrane domain f subunit; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f, isoform 2;
Gene ID 9551
mRNA Refseq NM_001003713
Protein Refseq NP_001003713
UniProt ID P56134

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ATP5J2 Products

Required fields are marked with *

My Review for All ATP5J2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon