Recombinant Human ATP5J2 Full Length Transmembrane protein, His-tagged

• Cat.No.: ATP5J2-1298H
• Product Overview: Recombinant Human ATP5J2 protein(P56134)(1-94aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.

Specification

• Source: In vitro E. coli expression system
• Species: Human
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 12.4 kDa
• Protein length: 1-94aa
• AA Sequence: MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: ATP5J2 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2 [ Homo sapiens ]
• Official Symbol: ATP5J2
• Synonyms: ATP5J2; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f, isoform 2 , ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F2; ATP synthase subunit f, mitochondrial; ATP synthase f chain; mitochondrial; ATP5JL; F1Fo ATP synthase complex Fo membrane domain f subunit; F1Fo ATPase; F1Fo ATPase synthase f subunit; F1F0-type ATPase subunit f; F1Fo-ATPase synthase f subunit; ATP synthase f chain, mitochondrial; F1Fo-ATP synthase complex Fo membrane domain f subunit; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f, isoform 2
• Gene ID: 9551
• mRNA Refseq: NM_001003713
• Protein Refseq: NP_001003713
• UniProt ID: P56134