Recombinant Human ATP5G1, GST-tagged

Cat.No. : ATP5G1-48H
Product Overview : Recombinant Human ATP5G1(18 a.a. - 136 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene is one of three genes that encode subunit c of the proton channel. Each of the three genes have distinct mitochondrial import sequences but encode the identical mature protein. Alternatively spliced transcript variants encoding the same protein have been identified.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 38.83 kDa
AA Sequence : TRGLIRPVSASFLSSPVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGS LIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATP5G1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9) [ Homo sapiens ]
Official Symbol ATP5G1
Synonyms ATP5G1; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9); ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1 , ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) , ATP5G; ATP synthase lipid-binding protein, mitochondrial; ATPase protein 9; ATPase subunit 9; ATPase subunit C; ATP synthase proteolipid P1; mitochondrial ATP synthase, subunit 9, isoform 1; mitochondrial ATP synthase, subunit C, isoform 1; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9); ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1; ATP5A; ATP5G
Gene ID 516
mRNA Refseq NM_001002027
Protein Refseq NP_001002027
MIM 603192
UniProt ID P05496
Chromosome Location 17q21.32
Pathway Alzheimers disease; Electron Transport Chain; F-type ATPase, eukaryotes
Function hydrogen ion transmembrane transporter activity; lipid binding; transporter activity

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ATP5G1 Products

Required fields are marked with *

My Review for All ATP5G1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon