Recombinant Human ATP5D protein, His-SUMO-tagged

• Cat.No.: ATP5D-2569H
• Product Overview: Recombinant Human ATP5D protein(P30049)(23-168aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 23-168aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 31 kDa
• AA Sequence: AEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: ATP5D ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit [ Homo sapiens ]
• Official Symbol: ATP5D
• Synonyms: ATP5D; ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit; ATP synthase subunit delta, mitochondrial; F-ATPase delta subunit; mitochondrial ATP synthase, delta subunit; mitochondrial ATP synthase complex delta-subunit precusor
• Gene ID: 513
• mRNA Refseq: NM_001001975
• Protein Refseq: NP_001001975
• MIM: 603150
• UniProt ID: P30049