Recombinant Human ATP5B, His-tagged

Cat.No. : ATP5B-26425TH
Product Overview : Recombinant fragment, corresponding to amino acids 156-529 of Human ATPB, with N terminal His tag, 374 amino acids, MWt 45kDa, ,
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 156-529 a.a.
Description : This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the beta subunit of the catalytic core.
Conjugation : HIS
Form : Lyophilised:Reconstitution with 143 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLLAP YAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVF AGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQ MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRF TQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTT KKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR AIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKI LQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLS QPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLP EQAFYMVGPIEEAVAKADKLAEEHSS
Sequence Similarities : Belongs to the ATPase alpha/beta chains family.
Gene Name ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide [ Homo sapiens ]
Official Symbol ATP5B
Synonyms ATP5B; ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide; ATPSB; ATP synthase subunit beta, mitochondrial;
Gene ID 506
mRNA Refseq NM_001686
Protein Refseq NP_001677
MIM 102910
Uniprot ID P06576
Chromosome Location 12p13.3
Pathway Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; F-type ATPase, eukaryotes, organism-specific biosystem; Formation of ATP by chemiosmotic coupling, organism-specific biosystem;
Function ATP binding; contributes_to ATPase activity; MHC class I protein binding; calcium ion binding; eukaryotic cell surface binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ATP5B Products

Required fields are marked with *

My Review for All ATP5B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon