Recombinant Human ATP2C1 protein, GST-tagged

• Cat.No.: ATP2C1-974H
• Product Overview: Human ATP2C1 partial ORF ( AAH28139, 119 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene belongs to the family of P-type cation transport ATPases. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium ions. Defects in this gene cause Hailey-Hailey disease, an autosomal dominant disorder. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 42.35 kDa
• AA Sequence: VQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATP2C1 ATPase, Ca++ transporting, type 2C, member 1 [ Homo sapiens ]
• Official Symbol: ATP2C1
• Synonyms: ATP2C1; ATPase, Ca++ transporting, type 2C, member 1; BCPM, benign chronic pemphigus (Hailey Hailey disease); calcium-transporting ATPase type 2C member 1; ATP2C1A; KIAA1347; PMR1; secretory pathway Ca2+/Mn2+ ATPase 1; SPCA1; HUSSY-28; ATPase 2C1; ATPase, Ca(2+)-sequestering; ATP-dependent Ca(2+) pump PMR1; HHD; BCPM; hSPCA1
• Gene ID: 27032
• mRNA Refseq: NM_001001485
• Protein Refseq: NP_001001485
• MIM: 604384
• UniProt ID: P98194