Recombinant Human ATP1B2 protein, GST-tagged

• Cat.No.: ATP1B2-966H
• Product Overview: Human ATP1B2 full-length ORF ( NP_001669.3, 1 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 2 subunit. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2014]
• Molecular Mass: 59.8 kDa
• AA Sequence: MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMWVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATP1B2 ATPase, Na+/K+ transporting, beta 2 polypeptide [ Homo sapiens ]
• Official Symbol: ATP1B2
• Synonyms: ATP1B2; ATPase, Na+/K+ transporting, beta 2 polypeptide; sodium/potassium-transporting ATPase subunit beta-2; AMOG; adhesion molecule on glia; Na, K-ATPase beta-2 polypeptide; sodium/potassium-dependent ATPase beta-2 subunit; sodium/potassium-dependent ATPase subunit beta-2; sodium/potassium-transporting ATPase beta-2 chain
• Gene ID: 482
• mRNA Refseq: NM_001678
• Protein Refseq: NP_001669
• MIM: 182331
• UniProt ID: P14415