Recombinant Human ATG4C protein, GST-tagged
Cat.No. : | ATG4C-950H |
Product Overview : | Human ATG4C full-length ORF ( NP_116241.2, 1 a.a. - 458 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding the same protein, have been characterized. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 78.9 kDa |
AA Sequence : | MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDHVIAGNVEEFRKDFISRIWLTYREEFPQIEGSALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALNIENSDSESWTSHTVKKFTASFEASLSGEREFKTPTISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKSGKKAGDWYGPAVVAHILRKAVEEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMTSDNADDKAVIILVPVRLGGERTNTDYLEFVKGILSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQSFVDVSIKDFPLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFKRASEEITKMLKFSSKEKYPLFTFVNGHSRDYDFTSTTTNEEDLFSEDEKKQLKRFSTEEFVLL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATG4C ATG4 autophagy related 4 homolog C (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ATG4C |
Synonyms | ATG4C; ATG4 autophagy related 4 homolog C (S. cerevisiae); APG4 autophagy 4 homolog C (S. cerevisiae) , APG4C, AUT (S. cerevisiae) like 1, cysteine endopeptidase; AUT like 1, cysteine endopeptidase (S. cerevisiae) , AUTL1; cysteine protease ATG4C; AUTL3; FLJ14867; autophagin-3; APG4 autophagy 4 homolog C; AUT-like 3 cysteine endopeptidase; AUT-like 1, cysteine endopeptidase; autophagy-related protein 4 homolog C; autophagy-related cysteine endopeptidase 3; APG4C; AUTL1; APG4-C; |
Gene ID | 84938 |
mRNA Refseq | NM_032852 |
Protein Refseq | NP_116241 |
MIM | 611339 |
UniProt ID | Q96DT6 |
◆ Recombinant Proteins | ||
ATG4C-1493HF | Recombinant Full Length Human ATG4C Protein, GST-tagged | +Inquiry |
ATG4C-442R | Recombinant Rhesus monkey ATG4C Protein, His-tagged | +Inquiry |
ATG4C-333Z | Recombinant Zebrafish ATG4C | +Inquiry |
Atg4c-1761M | Recombinant Mouse Atg4c Protein, Myc/DDK-tagged | +Inquiry |
ATG4C-7865H | Recombinant Human ATG4C, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATG4C-8623HCL | Recombinant Human ATG4C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATG4C Products
Required fields are marked with *
My Review for All ATG4C Products
Required fields are marked with *
0
Inquiry Basket