Recombinant Human ATG4C protein, GST-tagged

• Cat.No.: ATG4C-950H
• Product Overview: Human ATG4C full-length ORF ( NP_116241.2, 1 a.a. - 458 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding the same protein, have been characterized. [provided by RefSeq, Jul 2008]
• Molecular Mass: 78.9 kDa
• AA Sequence: MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDHVIAGNVEEFRKDFISRIWLTYREEFPQIEGSALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALNIENSDSESWTSHTVKKFTASFEASLSGEREFKTPTISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKSGKKAGDWYGPAVVAHILRKAVEEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMTSDNADDKAVIILVPVRLGGERTNTDYLEFVKGILSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQSFVDVSIKDFPLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFKRASEEITKMLKFSSKEKYPLFTFVNGHSRDYDFTSTTTNEEDLFSEDEKKQLKRFSTEEFVLL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATG4C ATG4 autophagy related 4 homolog C (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: ATG4C
• Synonyms: ATG4C; ATG4 autophagy related 4 homolog C (S. cerevisiae); APG4 autophagy 4 homolog C (S. cerevisiae) , APG4C, AUT (S. cerevisiae) like 1, cysteine endopeptidase; AUT like 1, cysteine endopeptidase (S. cerevisiae) , AUTL1; cysteine protease ATG4C; AUTL3; FLJ14867; autophagin-3; APG4 autophagy 4 homolog C; AUT-like 3 cysteine endopeptidase; AUT-like 1, cysteine endopeptidase; autophagy-related protein 4 homolog C; autophagy-related cysteine endopeptidase 3; APG4C; AUTL1; APG4-C
• Gene ID: 84938
• mRNA Refseq: NM_032852
• Protein Refseq: NP_116241
• MIM: 611339
• UniProt ID: Q96DT6