Recombinant Human ATG3, His-tagged

• Cat.No.: ATG3-35H
• Product Overview: Recombinant Human Ubiquitin-Like-Conjugating Enzyme ATG3/ATG3 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-His287) of Human ATG3 fused with a 6His tag at the C-terminus.

Specification

• Description: Ubiquitin-Like-Conjugating Enzyme ATG3 (ATG3) is widely expressed and has highly levels in heart, skeletal muscle, kidney, liver and placenta. ATG3 as a E2-like enzyme, involves in autophagy and mitochondrial homeostasis. ATG3 catalyzes the conjugation of ATG8-like proteins to PE which is essential for autophagy. As an autocatalytic E2-like enzyme, ATG3 also can catalyzes the conjugation of ATG12 to itself which palys a role in mitochondrial homeostasis but not in autophagy.
• Source: E. coli
• Species: Human
• Tag: His
• Form: Supplied as a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
• AA Sequence: MASMTGGQQMGRGSMQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCP TWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGI TGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEA CKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVT IENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHLEHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Store at Please minimize freeze-thaw cycles.

Gene Information

• Gene Name: ATG3 ATG3 autophagy related 3 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: ATG3
• Synonyms: ATG3; ATG3 autophagy related 3 homolog (S. cerevisiae); APG3 autophagy 3 like (S. cerevisiae) , APG3L; ubiquitin-like-conjugating enzyme ATG3; DKFZp564M1178; FLJ22125; MGC15201; PC3 96; hApg3; 2610016C12Rik; autophagy-related protein 3; APG3; APG3L; PC3-96; APG3-LIKE
• Gene ID: 64422
• mRNA Refseq: NM_022488
• Protein Refseq: NP_071933
• MIM: 609606
• UniProt ID: Q9NT62
• Chromosome Location: 3q13.2
• Pathway: Regulation of autophagy, organism-specific biosystem; Regulation of autophagy, conserved biosystem; Senescence and Autophagy, organism-specific biosystem
• Function: Atg12 ligase activity; Atg8 ligase activity; enzyme binding; ligase activity; protein binding; small conjugating protein ligase activity