Recombinant Human ATF2 protein(351-440 aa), C-His-tagged
Cat.No. : | ATF2-2659H |
Product Overview : | Recombinant Human ATF2 protein(P15336)(351-440 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 351-440 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | PDEKRRKFLERNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTADKDDSSED |
Gene Name | ATF2 activating transcription factor 2 [ Homo sapiens ] |
Official Symbol | ATF2 |
Synonyms | ATF2; activating transcription factor 2; cAMP responsive element binding protein 2 , CREB2; cyclic AMP-dependent transcription factor ATF-2; CRE BP1; HB16; TREB7; CREB-2; cAMP-dependent transcription factor ATF-2; cAMP-responsive element-binding protein 2; cAMP response element-binding protein CRE-BP1; cyclic AMP-responsive element-binding protein 2; cAMP responsive element binding protein 2, formerly; activating transcription factor 2 splice variant ATF2-var2; CREB2; CRE-BP1; MGC111558; |
Gene ID | 1386 |
mRNA Refseq | NM_001256090 |
Protein Refseq | NP_001243019 |
MIM | 123811 |
UniProt ID | P15336 |
◆ Recombinant Proteins | ||
ATF2-26187TH | Recombinant Human ATF2 | +Inquiry |
ATF2-27043TH | Recombinant Human ATF2, His-tagged | +Inquiry |
ATF2-1051HF | Recombinant Full Length Human ATF2 Protein, GST-tagged | +Inquiry |
ATF2-2562H | Recombinant Human ATF2 protein, His-SUMO-tagged | +Inquiry |
ATF2-692H | Active Recombinant Human ATF2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATF2-518HCL | Recombinant Human ATF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATF2 Products
Required fields are marked with *
My Review for All ATF2 Products
Required fields are marked with *
0
Inquiry Basket