Recombinant Human ATF2 protein(351-440 aa), C-His-tagged

• Cat.No.: ATF2-2659H
• Product Overview: Recombinant Human ATF2 protein(P15336)(351-440 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 351-440 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: PDEKRRKFLERNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTADKDDSSED

Gene Information

• Gene Name: ATF2 activating transcription factor 2 [ Homo sapiens ]
• Official Symbol: ATF2
• Synonyms: ATF2; activating transcription factor 2; cAMP responsive element binding protein 2 , CREB2; cyclic AMP-dependent transcription factor ATF-2; CRE BP1; HB16; TREB7; CREB-2; cAMP-dependent transcription factor ATF-2; cAMP-responsive element-binding protein 2; cAMP response element-binding protein CRE-BP1; cyclic AMP-responsive element-binding protein 2; cAMP responsive element binding protein 2, formerly; activating transcription factor 2 splice variant ATF2-var2; CREB2; CRE-BP1; MGC111558
• Gene ID: 1386
• mRNA Refseq: NM_001256090
• Protein Refseq: NP_001243019
• MIM: 123811
• UniProt ID: P15336