Recombinant Human ATAD1 protein, GST-tagged

Cat.No. : ATAD1-929H
Product Overview : Human ATAD1 full-length ORF ( AAH10868.1, 1 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ATAD1 (ATPase Family, AAA Domain Containing 1) is a Protein Coding gene. GO annotations related to this gene include ATPase activity and microtubule-severing ATPase activity.
Molecular Mass : 43.7 kDa
AA Sequence : MMKAQFMSLWDGLDTDHSCQVIVMGATNRPQDLDSAIMRRMPTRFHINQPALKQREAILKLILKNENVDRHVDLLEVAQETDGFSGSDLKEMCRDAALLCVREYVNSTSEESHDEDEIRPVQQQDLHRAIEKMKKSKDAAFQNVLTHVCLD
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATAD1 ATPase family, AAA domain containing 1 [ Homo sapiens ]
Official Symbol ATAD1
Synonyms ATAD1; ATPase family, AAA domain containing 1; ATPase family AAA domain-containing protein 1; FLJ14600; AFDC1; FNP001; THORASE;
Gene ID 84896
mRNA Refseq NM_032810
Protein Refseq NP_116199
MIM 614452
UniProt ID Q8NBU5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ATAD1 Products

Required fields are marked with *

My Review for All ATAD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon