Recombinant Human ASTN1, His-tagged

Cat.No. : ASTN1-9941H
Product Overview : Recombinant Human ASTN1(O14525)(Gly211-Thr360), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Gly211-Thr360
Tag : C-His
Form : Phosphate buffered saline
Molecular Mass : 18 kDa
Storage : Store at -20°C to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : GHGRESLRNARVQGHNSSGTLSIRETPILDGYEYDITDLRHHLQRECMNGGEDFASQVTRTLDSLQGCNEKSGMDLTPGSDNAKLSLMNKYKDNIIATSPVDSNHQQATLLSHTSSSQRKRINNKARAGSAFLNPEGDSGTEAENDPQLT
Gene Name ASTN1 astrotactin 1 [ Homo sapiens ]
Official Symbol ASTN1
Synonyms ASTN; Astrotactin 1; ASTROTACTIN; ASTN1; KIAA0289
Gene ID 460
mRNA Refseq NM_004319.1
Protein Refseq NP_004310.1
MIM 600904
UniProt ID O14525

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ASTN1 Products

Required fields are marked with *

My Review for All ASTN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon