Recombinant Human ASPH protein, His-tagged

• Cat.No.: ASPH-2896H
• Product Overview: Recombinant Human ASPH protein(1-203 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-203 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MAQRKNAKSSGNSSSSGSGSGSTSAGSSSPGARRETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVDYEEVLAKAKDFRYNLSEVLQGKLGIYDADGDGDFDVDDAKVLLGLTKDGSNENIDSLEEVLNILAEESSDWFYGFLSFLYDIMTPFEMLEEEEEESETADGVDGTSQNEGVQGKTCVILDLHNQ
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ASPH aspartate beta-hydroxylase [ Homo sapiens ]
• Official Symbol: ASPH
• Synonyms: ASPH; aspartate beta-hydroxylase; aspartyl/asparaginyl beta-hydroxylase; BAH; CASQ2BP1; HAAH; humbug; JCTN; junctate; junctin; A beta H-J-J; cardiac junctin; ASP beta-hydroxylase; peptide-aspartate beta-dioxygenase; aspartyl/asparaginyl-beta-hydroxylase; AAH
• Gene ID: 444
• mRNA Refseq: NM_001164750
• Protein Refseq: NP_001158222
• MIM: 600582
• UniProt ID: Q12797