Recombinant Human ASNS protein(201-560 aa), C-His-tagged

• Cat.No.: ASNS-2595H
• Product Overview: Recombinant Human ASNS protein(P08243)(201-560 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 201-560 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: MVKYHHCRDVPLHALYDNVEKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSAVK
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: ASNS asparagine synthetase (glutamine-hydrolyzing) [ Homo sapiens ]
• Official Symbol: ASNS
• Synonyms: ASNS; asparagine synthetase (glutamine-hydrolyzing); asparagine synthetase; asparagine synthetase [glutamine-hydrolyzing]; TS11 cell cycle control protein; glutamine-dependent asparagine synthetase; TS11
• Gene ID: 440
• mRNA Refseq: NM_001178075
• Protein Refseq: NP_001171546
• MIM: 108370
• UniProt ID: P08243