Recombinant Human ASF1A protein, His/T7-tagged

• Cat.No.: ASF1A-46H
• Product Overview: Recombinant Human ASF1A(Met1-Met204) fused with a T7 tag at the N-terminus, 6His tag at the C-terminus was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 1-204 a.a.
• Description: Human Histone Chaperone ASF1A (ASF1A) belongs to the H3/H4 family of histone chaperone proteins. ASF1A is ubiquitously expressed in many cells and tissues, interacting with histones H3 and H4. ASF1A cooperates with Chromatin Assembly Factor 1 to promote replication-dependent chromatin assembly and with HIRA to promote replication-independent chromatin assembly. In addition, ASF1A is necessary for the formation of senescence-associated heterochromatin foci (SAHF) and efficient senescence-associated cell cycle exit.
• Form: Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 1mM DTT, 150mM NaCl, pH 8.0.
• AA Sequence: MASMTGGQQMGRGSMAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESE EYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNE YTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPS ASKGWSTSENSLNVMLESHMDCMLEHHHHHH
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: ASF1A ASF1 anti-silencing function 1 homolog A (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: ASF1A
• Synonyms: ASF1A; ASF1 anti-silencing function 1 homolog A (S. cerevisiae); histone chaperone ASF1A; CIA; DKFZP547E2110; hCIA; hAsf1; hAsf1a; CCG1-interacting factor A; anti-silencing function 1A; anti-silencing function protein 1 homolog A; CGI-98; HSPC146
• Gene ID: 25842
• mRNA Refseq: NM_014034
• Protein Refseq: NP_054753
• MIM: 609189
• UniProt ID: Q9Y294
• Chromosome Location: 6q22.31
• Function: chromatin binding; histone binding; protein binding