Recombinant Human ASCL3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ASCL3-3306H
• Product Overview: ASCL3 MS Standard C13 and N15-labeled recombinant protein (NP_065697) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Basic helix-loop-helix transcription factors, such as ASCL3, are essential for the determination of cell fate and the development and differentiation of numerous tissues.
• Molecular Mass: 20.7 kDa
• AA Sequence: MMDNRGNSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSEPCPFSFPMPYPNYRGCEYSYGPAFTRKRNERERQRVKCVNEGYAQLRHHLPEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKVSSMIATTSHHADPMFRIVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ASCL3 achaete-scute family bHLH transcription factor 3 [ Homo sapiens (human) ]
• Official Symbol: ASCL3
• Synonyms: ASCL3; achaete-scute complex homolog 3 (Drosophila); achaete scute complex (Drosophila) homolog like 3; achaete-scute homolog 3; bHLHa42; HASH3; Sgn1; ASH-3; bHLH transcriptional regulator Sgn-1; class A basic helix-loop-helix protein 42; bHLH transcription factor Sgn-1 (Salivary Glands 1); SGN1
• Gene ID: 56676
• mRNA Refseq: NM_020646
• Protein Refseq: NP_065697
• MIM: 609154
• UniProt ID: Q9NQ33