Recombinant Human ASCL2 protein, GST-tagged

• Cat.No.: ASCL2-905H
• Product Overview: Recombinant Human ASCL2(1 a.a. - 193 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• ProteinLength: 1 a.a. - 193 a.a.
• Description: This gene is a member of the basic helix-loop-helix (BHLH) family of transcription factors. It activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. Involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 46.6 kDa
• AA Sequence: MDGGTLPRSAPPAPPVPVGCAARRRPASPELLRCSRRRRPATAETGGGAAAVARRNERERNRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGLRPQAVRPSAPRGPPGTTPVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAERELLDFSSWLGGY
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: ASCL2 achaete-scute complex homolog 2 (Drosophila) [ Homo sapiens ]
• Official Symbol: ASCL2
• Synonyms: ASCL2; achaete-scute complex homolog 2 (Drosophila); achaete scute complex (Drosophila) homolog like 2 , achaete scute complex like 2 (Drosophila); achaete-scute homolog 2; ASH2; bHLHa45; HASH2; ASH-2; achaete-scute complex-like 2; mammalian achaete/scute homologue 2; class A basic helix-loop-helix protein 45; MASH2
• Gene ID: 430
• mRNA Refseq: NM_005170
• Protein Refseq: NP_005161
• MIM: 601886
• UniProt ID: Q99929