Recombinant Human ASB6 protein, GST-tagged

• Cat.No.: ASB6-895H
• Product Overview: Human ASB6 full-length ORF ( AAH01719, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene belongs to a family of ankyrin repeat proteins that, along with four other protein families, contain a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box, similar to the F-box, acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases. Alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Jan 2011]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 47.41 kDa
• AA Sequence: MPFLHGFRRIIFEYQPLVDAIPGSLGIQDPERQESLDRPSYVASEESRILVLTELLERKAHSPFYQEGVSNALLKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLVHHGADVNRRDREKLLCSMLWPAATGCRSTILRTFVSYWKEGQTSRPPPKMGTQCSPASSSCLVRPWEGTKRRPR
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ASB6 ankyrin repeat and SOCS box containing 6 [ Homo sapiens ]
• Official Symbol: ASB6
• Synonyms: ASB6; ankyrin repeat and SOCS box containing 6; ankyrin repeat and SOCS box protein 6; ankyrin repeat and SOCS box-containing 6; MGC1024; FLJ20548
• Gene ID: 140459
• mRNA Refseq: NM_001202403
• Protein Refseq: NP_001189332
• UniProt ID: Q9NWX5