Recombinant Human ASB6 protein, GST-tagged

Cat.No. : ASB6-895H
Product Overview : Human ASB6 full-length ORF ( AAH01719, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene belongs to a family of ankyrin repeat proteins that, along with four other protein families, contain a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box, similar to the F-box, acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases. Alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Jan 2011]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 47.41 kDa
AA Sequence : MPFLHGFRRIIFEYQPLVDAIPGSLGIQDPERQESLDRPSYVASEESRILVLTELLERKAHSPFYQEGVSNALLKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLVHHGADVNRRDREKLLCSMLWPAATGCRSTILRTFVSYWKEGQTSRPPPKMGTQCSPASSSCLVRPWEGTKRRPR
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ASB6 ankyrin repeat and SOCS box containing 6 [ Homo sapiens ]
Official Symbol ASB6
Synonyms ASB6; ankyrin repeat and SOCS box containing 6; ankyrin repeat and SOCS box protein 6; ankyrin repeat and SOCS box-containing 6; MGC1024; FLJ20548;
Gene ID 140459
mRNA Refseq NM_001202403
Protein Refseq NP_001189332
UniProt ID Q9NWX5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ASB6 Products

Required fields are marked with *

My Review for All ASB6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon