Recombinant Human ASAH2 protein, His-tagged

• Cat.No.: ASAH2-115H
• Product Overview: Recombinant Human ASAH2 protein(Q9NR71)(610-780aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 25.2 kDa
• Protein length: 610-780aa
• AA Sequence: FRNLAKAIATDTVANLSRGPEPPFFKQLIVPLIPSIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: ASAH2 N-acylsphingosine amidohydrolase (non-lysosomal ceramidase) 2 [ Homo sapiens ]
• Official Symbol: ASAH2
• Synonyms: ASAH2; N-acylsphingosine amidohydrolase (non-lysosomal ceramidase) 2; neutral ceramidase; mitochondrial ceramidase; non-lysosomal ceramidase; acylsphingosine deacylase 2; neutral/alkaline ceramidase; N-acylsphingosine amidohydrolase 2; HNAC1; BCDase; LCDase; NCDase; N-CDase
• Gene ID: 56624
• mRNA Refseq: NM_001143974
• Protein Refseq: NP_001137446
• MIM: 611202
• UniProt ID: Q9NR71