Recombinant Human ASAH1

Description :	This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally. The encoded protein catalyzes the synthesis and degradation of ceramide into sphingosine and fatty acid. Mutations in this gene have been associated with a lysosomal storage disorder known as Farber disease. Multiple transcript variants encoding several distinct isoforms have been identified for this gene.
Protein length :	100 amino acids
Molecular Weight :	36.630kDa inclusive of tags
Source :	Wheat germ
Tissue specificity :	Broadly expressed with highest expression in heart.
Form :	Liquid
Purity :	Proprietary Purification
Storage buffer :	pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage :	Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids :	PPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYKRWHELMLDKAPMLKVIVNSLKNMINTFVPSGKVMQVVDEKLPGLLGNFPGPFEEEMKGIAAVTD
Sequence Similarities :	Belongs to the acid ceramidase family.
Tag :	Non

Gene Name	ASAH1 N-acylsphingosine amidohydrolase (acid ceramidase) 1 [ Homo sapiens ]
Official Symbol	ASAH1
Synonyms	ASAH1; N-acylsphingosine amidohydrolase (acid ceramidase) 1; ASAH, N acylsphingosine amidohydrolase (acid ceramidase); acid ceramidase; AC; FLJ21558; PHP32;
Gene ID	427
mRNA Refseq	NM_001127505
Protein Refseq	NP_001120977
MIM	613468
Uniprot ID	Q13510
Chromosome Location	8p22
Pathway	Ceramide signaling pathway, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Metabolic pathways, organism-specific biosystem; Signal Transduction of S1P Receptor, organism-specific biosystem;
Function	catalytic activity; ceramidase activity; hydrolase activity;