Recombinant Human AS3MT protein, GST-tagged
Cat.No. : | AS3MT-877H |
Product Overview : | Human AS3MT full-length ORF ( AAI60057.1, 1 a.a. - 375 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | AS3MT catalyzes the transfer of a methyl group from S-adenosyl-L-methionine (AdoMet) to trivalent arsenical and may play a role in arsenic metabolism (Lin et al., 2002 [PubMed 11790780]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 67.65 kDa |
AA Sequence : | MAALRDAEIQKDVQTYYGQVLKRSADLQTNGCVTTARPVPKHIREALQNVHEEVALRYYGCGLVIPEHLENCWILDLGSGSGRDCYVLSQLVGEKGHVTGIDMTKGQVEVAEKYLDYHMEKYGFQASNVTFIHGYIEKLGEAGIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLELPEEIRTHKVLWGECLGGALYWKELAVLAQKIGFCPPRLVTANLITIQNKELERVIGDCRFVSATFRLFKHSKTGPTKRCQVIYNGGITGHEKELMFDANFTFKEGEIVEVDEETAAILKNSRFAQDFLIRPIGEKLPTSGGCSALELKDIITDPFKLAEESDSMKSRCVPDAAGGCCGTKKSC |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AS3MT arsenic (+3 oxidation state) methyltransferase [ Homo sapiens ] |
Official Symbol | AS3MT |
Synonyms | AS3MT; arsenic (+3 oxidation state) methyltransferase; arsenite methyltransferase; CYT19; methyltransferase cyt19; methylarsonite methyltransferase; S-adenosylmethionine:arsenic (III) methyltransferase; S-adenosyl-L-methionine:arsenic(III) methyltransferase; RP11-753C18.6; |
Gene ID | 57412 |
mRNA Refseq | NM_020682 |
Protein Refseq | NP_065733 |
MIM | 611806 |
UniProt ID | Q9HBK9 |
◆ Recombinant Proteins | ||
AS3MT-469R | Recombinant Rat AS3MT Protein, His (Fc)-Avi-tagged | +Inquiry |
As3mt-1732M | Recombinant Mouse As3mt Protein, Myc/DDK-tagged | +Inquiry |
AS3MT-2825H | Recombinant Human AS3MT Protein, MYC/DDK-tagged | +Inquiry |
AS3MT-770M | Recombinant Mouse AS3MT Protein, His (Fc)-Avi-tagged | +Inquiry |
AS3MT-3675Z | Recombinant Zebrafish AS3MT | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AS3MT Products
Required fields are marked with *
My Review for All AS3MT Products
Required fields are marked with *
0
Inquiry Basket