Recombinant Human ARPC5 protein, GST-tagged

• Cat.No.: ARPC5-849H
• Product Overview: Human ARPC5 full-length ORF ( AAH57237, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p16 subunit, has yet to be determined. Alternatively spliced transcript variants encoding different isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 42.68 kDa
• AA Sequence: MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARPC5 actin related protein 2/3 complex, subunit 5, 16kDa [ Homo sapiens ]
• Official Symbol: ARPC5
• Synonyms: ARPC5; actin related protein 2/3 complex, subunit 5, 16kDa; actin related protein 2/3 complex, subunit 5 (16 kD); actin-related protein 2/3 complex subunit 5; ARC16; Arp2/3 protein complex subunit p16; dJ127C7.3; p16 Arc; arp2/3 complex 16 kDa subunit; p16-Arc; MGC88523
• Gene ID: 10092
• mRNA Refseq: NM_005717
• Protein Refseq: NP_005708
• MIM: 604227
• UniProt ID: O15511