Recombinant Human ARPC5 protein, GST-tagged
Cat.No. : | ARPC5-849H |
Product Overview : | Human ARPC5 full-length ORF ( AAH57237, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p16 subunit, has yet to be determined. Alternatively spliced transcript variants encoding different isoforms have been observed for this gene. [provided by RefSeq, Jul 2012] |
Molecular Mass : | 42.68 kDa |
AA Sequence : | MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARPC5 actin related protein 2/3 complex, subunit 5, 16kDa [ Homo sapiens ] |
Official Symbol | ARPC5 |
Synonyms | ARPC5; actin related protein 2/3 complex, subunit 5, 16kDa; actin related protein 2/3 complex, subunit 5 (16 kD); actin-related protein 2/3 complex subunit 5; ARC16; Arp2/3 protein complex subunit p16; dJ127C7.3; p16 Arc; arp2/3 complex 16 kDa subunit; p16-Arc; MGC88523; |
Gene ID | 10092 |
mRNA Refseq | NM_005717 |
Protein Refseq | NP_005708 |
MIM | 604227 |
UniProt ID | O15511 |
◆ Recombinant Proteins | ||
ARPC5-750M | Recombinant Mouse ARPC5 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARPC5-3203C | Recombinant Chicken ARPC5 | +Inquiry |
ARPC5-2106H | Recombinant Human ARPC5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARPC5-3539H | Recombinant Human ARPC5, His-tagged | +Inquiry |
ARPC5-849H | Recombinant Human ARPC5 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARPC5-8683HCL | Recombinant Human ARPC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARPC5 Products
Required fields are marked with *
My Review for All ARPC5 Products
Required fields are marked with *
0
Inquiry Basket