Recombinant Human ARPC4 protein, GST-tagged

• Cat.No.: ARPC4-848H
• Product Overview: Human ARPC4 full-length ORF ( NP_001020130.1, 1 a.a. - 78 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes one of seven subunits of the human Arp2/3 protein complex. This complex controls actin polymerization in cells and has been conserved throughout eukaryotic evolution. This gene encodes the p20 subunit, which is necessary for actin nucleation and high-affinity binding to F-actin. Alternative splicing results in multiple transcript variants. Naturally occurring read-through transcription exists between this gene and the downstream tubulin tyrosine ligase-like family, member 3 (TTLL3), which results in the production of a fusion protein. [provided by RefSeq, Nov 2010]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36 kDa
• AA Sequence: MRFMMMRAENFFILRRKPVEGYDISFLITNFHTEQMYKHKLVDFVIHFMEEIDKEISEMKLSVNARARIVAEEFLKNF
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARPC4 actin related protein 2/3 complex, subunit 4, 20kDa [ Homo sapiens ]
• Official Symbol: ARPC4
• Synonyms: ARPC4; actin related protein 2/3 complex, subunit 4, 20kDa; actin related protein 2/3 complex, subunit 4 (20 kD); actin-related protein 2/3 complex subunit 4; actin related protein 2/3 complex; subunit 4 (20 kD); ARC20; Arp2/3 protein complex subunit p20; p20 Arc; arp2/3 complex 20 kDa subunit; arp2/3 protein complex subunit p20; P20-ARC; MGC13544
• Gene ID: 10093
• mRNA Refseq: NM_001024959
• Protein Refseq: NP_001020130
• MIM: 604226
• UniProt ID: P59998