Recombinant Human ARMC8 protein, GST-tagged

• Cat.No.: ARMC8-831H
• Product Overview: Human ARMC8 full-length ORF ( NP_054873.2, 1 a.a. - 385 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ARMC8 (Armadillo Repeat Containing 8) is a Protein Coding gene. Among its related pathways are Immune System. GO annotations related to this gene include binding.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 69.4 kDa
• AA Sequence: MEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLMALLSRSRYTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLLEERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKLYASLGANDEDIRKKVSLGEGRPPVLTASRQGVTST
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARMC8 armadillo repeat containing 8 [ Homo sapiens ]
• Official Symbol: ARMC8
• Synonyms: ARMC8; armadillo repeat containing 8; armadillo repeat-containing protein 8; DKFZP434A043; HSPC056; S863-2; MGC4880; MGC10058
• Gene ID: 25852
• mRNA Refseq: NM_014154
• Protein Refseq: NP_054873
• UniProt ID: Q8IUR7