Recombinant Human ARMC6, His-tagged
Cat.No. : | ARMC6-26183TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 207-476 of Human ARMC6 with N terminal His tag; 270 amino acids, 33kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 207-476 a.a. |
Description : | The function of this genes protein product has not been determined. A related protein in mouse suggests that this protein has a conserved function. Two transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 134 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | HGHHTDVVREACWALRVMTFDDDIRVPFGHAHNHAKMIVQ ENKGLKVLIEATKAFLDNPGILSELCGTLSRLAIRNEF CQEVVDLGGLSILVSLLADCNDHQMRDQSGVQELVKQVLSTLRAIAGNDDVKDAIVRAGGTESIVAAMTQHLTSPQVC EQSCAALCFLALRKPDNSRIIVEGGGAVAALQAMKAHP QKAGVQKQACMLIRNLVAHGQAFSKPILDLGAEALIMQARSAHRDCEDVAKAALRDLGCHVELRELWTGQRGNLAP |
Gene Name | ARMC6 armadillo repeat containing 6 [ Homo sapiens ] |
Official Symbol | ARMC6 |
Synonyms | ARMC6; armadillo repeat containing 6; armadillo repeat-containing protein 6; MGC19595; |
Gene ID | 93436 |
mRNA Refseq | NM_033415 |
Protein Refseq | NP_219483 |
Uniprot ID | Q6NXE6 |
Chromosome Location | 19p13 |
Function | binding; |
◆ Recombinant Proteins | ||
Cntn6-1525M | Recombinant Mouse Cntn6 protein, His & T7-tagged | +Inquiry |
RFL7714AF | Recombinant Full Length Anopheles Gambiae Adp,Atp Carrier Protein 2(Agap002358) Protein, His-Tagged | +Inquiry |
ROR2-799H | Recombinant Human ROR2 Protein, MYC/DDK-tagged | +Inquiry |
H2AFY-133H | Recombinant Human H2AFY Protein, HIS-tagged | +Inquiry |
SASH1-3634H | Recombinant Human SASH1 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CKB-46M | Native Mouse Creatine Kinase, Brain (CKB) Protein | +Inquiry |
ORM1-110H | Native Human Alpha 1 Acid Glycoprotein (A1AGP) | +Inquiry |
LDL-393H | Native Human Low Density Lipoprotein | +Inquiry |
Lectin-1847S | Active Native Soybean Agglutinin Protein, Fluorescein labeled | +Inquiry |
NTF3-29249TH | Native Human NTF3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LADMAC-966M | LADMAC (mouse bone marrow, producing colony stimulating factor-1) whole cell lysate | +Inquiry |
PER1-1332HCL | Recombinant Human PER1 cell lysate | +Inquiry |
FSTL1-2679HCL | Recombinant Human FSTL1 cell lysate | +Inquiry |
C7orf59-7960HCL | Recombinant Human C7orf59 293 Cell Lysate | +Inquiry |
SLPI-530HCL | Recombinant Human SLPI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARMC6 Products
Required fields are marked with *
My Review for All ARMC6 Products
Required fields are marked with *
0
Inquiry Basket