Recombinant Human ARL6IP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ARL6IP1-6509H
Product Overview : ARL6IP1 MS Standard C13 and N15-labeled recombinant protein (NP_055976) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene belongs to the ARL6ip family and encodes a transmembrane protein that is predominantly localized to intracytoplasmic membranes. It is highly expressed in early myeloid progenitor cells and thought to be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation. Mutations in this gene are associated with spastic paraplegia 61 (SPG61). Alternatively spliced transcript variants have been found for this gene.
Molecular Mass : 23.4 kDa
AA Sequence : MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ARL6IP1 ADP-ribosylation factor-like 6 interacting protein 1 [ Homo sapiens (human) ]
Official Symbol ARL6IP1
Synonyms ARL6IP1; ADP-ribosylation factor-like 6 interacting protein 1; ADP ribosylation factor like 6 interacting protein, ARL6IP; ADP-ribosylation factor-like protein 6-interacting protein 1; AIP1; ARMER; KIAA0069; aip-1; ARL-6-interacting protein 1; apoptotic regulator in the membrane of the endoplasmic reticulum; ARL6IP;
Gene ID 23204
mRNA Refseq NM_015161
Protein Refseq NP_055976
MIM 607669
UniProt ID Q15041

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ARL6IP1 Products

Required fields are marked with *

My Review for All ARL6IP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon