Recombinant Human ARL15 protein, GST-tagged

• Cat.No.: ARL15-806H
• Product Overview: Human ARL15 full-length ORF ( NP_061960.1, 1 a.a. - 204 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ARL15 (ADP Ribosylation Factor Like GTPase 15) is a Protein Coding gene. GO annotations related to this gene include GTP binding. An important paralog of this gene is ARL8A.
• Molecular Mass: 49.3 kDa
• AA Sequence: MSDLRITEAFLYMDYLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEEKDHEAVRM
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARL15 ADP-ribosylation factor-like 15 [ Homo sapiens ]
• Official Symbol: ARL15
• Synonyms: ARL15; ADP-ribosylation factor-like 15; ADP ribosylation factor related protein 2 , ARFRP2; ADP-ribosylation factor-like protein 15; FLJ20051; ARF-related protein 2; ADP-ribosylation factor related protein 2; ADP-ribosylation factor-related protein 2; ARFRP2
• Gene ID: 54622
• mRNA Refseq: NM_019087
• Protein Refseq: NP_061960
• UniProt ID: Q9NXU5