Recombinant Human ARID3C protein, GST-tagged

• Cat.No.: ARID3C-796H
• Product Overview: Human ARID3C full-length ORF ( AAI48444.1, 1 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene is a member of the ARID (AT-rich interaction domain) family of proteins. The ARID domain is a helix-turn-helix motif-based DNA-binding domain. ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 71.72 kDa
• AA Sequence: MEALQKQQAARLAQGVGPLAPACPLLPPQPPLPDHRTLQAPEGALGNVGAEEEEDAEEDEEKREEAGAEEEAAEESRPGAQGPSSPSSQPPGLHPHEWTYEEQFKQLYELDADPKRKEFLDDLFSFMQKRGTPVNRVPIMAKQVLDLYALFRLVTAKGGLVEVINRKVWREVTRGLSLPTTITSAAFTLRTQYMKYLYPYECETRALSSPGELQAAIDSNRREGRRQAYTATPLFGLAGPPPRGAQDPALGPGPAPPATQSSPGPAQGSTSGLPAHACAQLSPSPIKKEESGIPNPCLALPVGLALGPTREKLAPEEPPEKRAVLMGPMDPPRPCMPPSFLPRGKVPLREERLDGPLNLAGSGISSINMALEINGVVYTGVLFARRQPVPASQGPTNPAPPPSTGPPSSILP
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARID3C AT rich interactive domain 3C (BRIGHT-like) [ Homo sapiens ]
• Official Symbol: ARID3C
• Synonyms: ARID3C; AT rich interactive domain 3C (BRIGHT-like); AT rich interactive domain 3C (BRIGHT like); AT-rich interactive domain-containing protein 3C; ARID domain-containing protein 3C
• Gene ID: 138715
• mRNA Refseq: NM_001017363
• Protein Refseq: NP_001017363
• UniProt ID: A6NKF2