Recombinant Human ARFIP1 protein, GST-tagged

Cat.No. : ARFIP1-753H
Product Overview : Human ARFIP1 full-length ORF ( NP_001020766.1, 1 a.a. - 373 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ARFIP1 (ADP Ribosylation Factor Interacting Protein 1) is a Protein Coding gene. GO annotations related to this gene include protein domain specific binding and phosphatidylinositol-4-phosphate binding. An important paralog of this gene is ARFIP2.
Molecular Mass : 68.1 kDa
AA Sequence : MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGLSETQITSHGFDNTKEGVIEAGAFQGSPAPPLPSVMSPSRVAASRLAQQGSDLIVPAGGQRTQTKSGPVILADEIKNPAMEKLELVRKWSLNTYKCTRQIISEKLGRGSRTVDLELEAQIDILRDNKKKYENILKLAQTLSTQLFQMVHTQRQLGDAFADLSLKSLELHEEFGYNADTQKLLAKNGETLLGAINFFIASVNTLVNKTIEDTLMTVKQYESARIEYDAYRTDLEELNLGPRDANTLPKIEQSQHLFQAHKEKYDKMRNDVSVKLKFLEENKVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLKQFHIKLKTPGVDAPSWLEEQ
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARFIP1 ADP-ribosylation factor interacting protein 1 [ Homo sapiens ]
Official Symbol ARFIP1
Synonyms ARFIP1; ADP-ribosylation factor interacting protein 1; arfaptin-1; arfaptin 1; HSU52521; ADP-ribosylation factor-interacting protein 1; MGC117369;
Gene ID 27236
mRNA Refseq NM_001025593
Protein Refseq NP_001020764
MIM 605928
UniProt ID P53367

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ARFIP1 Products

Required fields are marked with *

My Review for All ARFIP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon