Recombinant Human ARFIP1 protein, GST-tagged

• Cat.No.: ARFIP1-753H
• Product Overview: Human ARFIP1 full-length ORF ( NP_001020766.1, 1 a.a. - 373 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ARFIP1 (ADP Ribosylation Factor Interacting Protein 1) is a Protein Coding gene. GO annotations related to this gene include protein domain specific binding and phosphatidylinositol-4-phosphate binding. An important paralog of this gene is ARFIP2.
• Molecular Mass: 68.1 kDa
• AA Sequence: MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGLSETQITSHGFDNTKEGVIEAGAFQGSPAPPLPSVMSPSRVAASRLAQQGSDLIVPAGGQRTQTKSGPVILADEIKNPAMEKLELVRKWSLNTYKCTRQIISEKLGRGSRTVDLELEAQIDILRDNKKKYENILKLAQTLSTQLFQMVHTQRQLGDAFADLSLKSLELHEEFGYNADTQKLLAKNGETLLGAINFFIASVNTLVNKTIEDTLMTVKQYESARIEYDAYRTDLEELNLGPRDANTLPKIEQSQHLFQAHKEKYDKMRNDVSVKLKFLEENKVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLKQFHIKLKTPGVDAPSWLEEQ
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARFIP1 ADP-ribosylation factor interacting protein 1 [ Homo sapiens ]
• Official Symbol: ARFIP1
• Synonyms: ARFIP1; ADP-ribosylation factor interacting protein 1; arfaptin-1; arfaptin 1; HSU52521; ADP-ribosylation factor-interacting protein 1; MGC117369
• Gene ID: 27236
• mRNA Refseq: NM_001025593
• Protein Refseq: NP_001020764
• MIM: 605928
• UniProt ID: P53367