Recombinant Human ARF4L protein, GST-tagged

• Cat.No.: ARF4L-747H
• Product Overview: Human ARF4L partial ORF ( AAH00043, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ADP-ribosylation factor 4D is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4D is closely similar to ARL4A and ARL4C and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in membrane-associated intracellular trafficking. Mutations in this gene have been associated with Bardet-Biedl syndrome (BBS). [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFV
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARL4D ADP ribosylation factor like GTPase 4D [ Homo sapiens (human) ]
• Official Symbol: ARL4D
• Synonyms: ARL4D; ADP ribosylation factor like GTPase 4D; ARL6; ARF4L; ADP-ribosylation factor-like protein 4D; ADP-ribosylation factor-like 4D; ADP-ribosylation factor-like 6; ADP-ribosylation factor-like protein 4L
• Gene ID: 379
• mRNA Refseq: NM_001661
• Protein Refseq: NP_001652
• MIM: 600732
• UniProt ID: P49703