Recombinant Human ARF1 protein, His-GST & Myc-tagged
Cat.No. : | ARF1-2544H |
Product Overview : | Recombinant Human ARF1 protein(P84077)(2-181aa), fused to N-terminal His tag and GST tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His&Myc |
Protein Length : | 2-181aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 50.6 kDa |
AA Sequence : | GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ARF1 ADP-ribosylation factor 1 [ Homo sapiens ] |
Official Symbol | ARF1 |
Synonyms | ARF1; ADP-ribosylation factor 1; |
Gene ID | 375 |
mRNA Refseq | NM_001024226 |
Protein Refseq | NP_001019397 |
MIM | 103180 |
UniProt ID | P84077 |
◆ Recombinant Proteins | ||
Arf1-634M | Recombinant Mouse Arf1 Protein, MYC/DDK-tagged | +Inquiry |
ARF1-58C | Recombinant Cynomolgus Monkey ARF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARF1-11499Z | Recombinant Zebrafish ARF1 | +Inquiry |
ARF1-747R | Recombinant Rat ARF1 Protein | +Inquiry |
ARF1-224H | Recombinant Human ARF1 protein(Met1-Lys181), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARF1-8760HCL | Recombinant Human ARF1 293 Cell Lysate | +Inquiry |
ARF1-8761HCL | Recombinant Human ARF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARF1 Products
Required fields are marked with *
My Review for All ARF1 Products
Required fields are marked with *
0
Inquiry Basket