Recombinant Human ARF1 protein, GST-tagged
Cat.No. : | ARF1-744H |
Product Overview : | Human ARF1 full-length ORF ( AAH11358, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ADP-ribosylation factor 1 (ARF1) is a member of the human ARF gene family. The family members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. The gene products, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 45.65 kDa |
AA Sequence : | MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDVVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARF1 ADP-ribosylation factor 1 [ Homo sapiens ] |
Official Symbol | ARF1 |
Synonyms | ARF1; ADP-ribosylation factor 1; |
Gene ID | 375 |
mRNA Refseq | NM_001024226 |
Protein Refseq | NP_001019397 |
MIM | 103180 |
UniProt ID | P84077 |
◆ Recombinant Proteins | ||
ARF1-506H | Recombinant Human ARF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARF1-1837M | Recombinant Mouse ARF1 Protein | +Inquiry |
ARF1-9799H | Recombinant Human ARF1 protein(Met1-Lys181), GST-tagged | +Inquiry |
Arf1-634M | Recombinant Mouse Arf1 Protein, MYC/DDK-tagged | +Inquiry |
ARF1-7852H | Recombinant Human ARF1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARF1-8760HCL | Recombinant Human ARF1 293 Cell Lysate | +Inquiry |
ARF1-8761HCL | Recombinant Human ARF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARF1 Products
Required fields are marked with *
My Review for All ARF1 Products
Required fields are marked with *
0
Inquiry Basket