Recombinant Human APP protein, His-tagged
Cat.No. : | APP-3646H |
Product Overview : | Recombinant Human APP protein(653-751 aa), fused to His tag, was expressed in E. coli. |
Availability | April 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 653-751 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | APP amyloid beta (A4) precursor protein [ Homo sapiens ] |
Official Symbol | APP |
Synonyms | APP; amyloid beta (A4) precursor protein; AD1, Alzheimer disease; amyloid beta A4 protein; peptidase nexin II; preA4; protease nexin-II; peptidase nexin-II; beta-amyloid peptide; alzheimer disease amyloid protein; cerebral vascular amyloid peptide; AAA; AD1; PN2; ABPP; APPI; CVAP; ABETA; PN-II; CTFgamma; |
Gene ID | 351 |
mRNA Refseq | NM_000484 |
Protein Refseq | NP_000475 |
MIM | 104760 |
UniProt ID | P05067 |
◆ Recombinant Proteins | ||
APP-001H | Human β-Amyloid (1-42) | +Inquiry |
APP-23H | Active Recombinant Human APP Protein (18-701aa), C-His tagged | +Inquiry |
AK5-8433H | Recombinant Human AK5 protein, GST-tagged | +Inquiry |
APP-192H | Active Recombinant Human APP Protein, His/GST-tagged | +Inquiry |
App-5746M | Recombinant Mouse App protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APP-3087HCL | Recombinant Human APP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APP Products
Required fields are marked with *
My Review for All APP Products
Required fields are marked with *
0
Inquiry Basket