Tag :	N-GST
ProteinLength :	673-714 aa
Tag :	N-GST
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AASequence :	AEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHH
Purity :	85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage :	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution :	Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Name	APP amyloid beta (A4) precursor protein [ Homo sapiens ]
Official Symbol	APP
Synonyms	APP; amyloid beta (A4) precursor protein; AD1, Alzheimer disease; amyloid beta A4 protein; peptidase nexin II; preA4; protease nexin-II; peptidase nexin-II; beta-amyloid peptide; alzheimer disease amyloid protein; cerebral vascular amyloid peptide; AAA; AD1; PN2; ABPP; APPI; CVAP; ABETA; PN-II; CTFgamma;
Gene ID	351
mRNA Refseq	NM_000484
Protein Refseq	NP_000475
MIM	104760
UniProt ID	P05067

COA

Cat.No. :	APP-7854H
Product Overview :	Recombinant Human APP protein(673-714 aa), fused with N-terminal GST tag, was expressed in E. coli.

Recombinant Human APP protein, GST-tagged