Recombinant Human APOM protein, GST-tagged

• Cat.No.: APOM-718H
• Product Overview: Human APOM full-length ORF ( AAH20683, 23 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is an apolipoprotein and member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. The encoded protein is secreted through the plasma membrane but remains membrane-bound, where it is involved in lipid transport. Alternate splicing results in both coding and non-coding variants of this gene. [provided by RefSeq, Jan 2012]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 44 kDa
• AA Sequence: CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: APOM apolipoprotein M [ Homo sapiens ]
• Official Symbol: APOM
• Synonyms: APOM; apolipoprotein M; ApoM; G3a; NG20; protein G3a; NG20-like protein; alternative name: G3a, NG20; apo-M; HSPC336; MGC22400
• Gene ID: 55937
• mRNA Refseq: NM_001256169
• Protein Refseq: NP_001243098
• MIM: 606907
• UniProt ID: O95445