Recombinant Human APOM protein, GST-tagged
Cat.No. : | APOM-718H |
Product Overview : | Human APOM full-length ORF ( AAH20683, 23 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is an apolipoprotein and member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. The encoded protein is secreted through the plasma membrane but remains membrane-bound, where it is involved in lipid transport. Alternate splicing results in both coding and non-coding variants of this gene. [provided by RefSeq, Jan 2012] |
Molecular Mass : | 44 kDa |
AA Sequence : | CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | APOM apolipoprotein M [ Homo sapiens ] |
Official Symbol | APOM |
Synonyms | APOM; apolipoprotein M; ApoM; G3a; NG20; protein G3a; NG20-like protein; alternative name: G3a, NG20; apo-M; HSPC336; MGC22400; |
Gene ID | 55937 |
mRNA Refseq | NM_001256169 |
Protein Refseq | NP_001243098 |
MIM | 606907 |
UniProt ID | O95445 |
◆ Recombinant Proteins | ||
APOM-2209M | Recombinant Mouse APOM Protein (1-190 aa), His-tagged | +Inquiry |
APOM-1241HF | Recombinant Full Length Human APOM Protein, GST-tagged | +Inquiry |
APOM-2471H | Recombinant Human APOM Protein, MYC/DDK-tagged | +Inquiry |
APOM-729R | Recombinant Rat APOM Protein | +Inquiry |
APOM-7870Z | Recombinant Zebrafish APOM | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOM-1594HCL | Recombinant Human APOM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOM Products
Required fields are marked with *
My Review for All APOM Products
Required fields are marked with *
0
Inquiry Basket