Recombinant Human APOM protein, GST-tagged

Cat.No. : APOM-718H
Product Overview : Human APOM full-length ORF ( AAH20683, 23 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is an apolipoprotein and member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. The encoded protein is secreted through the plasma membrane but remains membrane-bound, where it is involved in lipid transport. Alternate splicing results in both coding and non-coding variants of this gene. [provided by RefSeq, Jan 2012]
Molecular Mass : 44 kDa
AA Sequence : CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name APOM apolipoprotein M [ Homo sapiens ]
Official Symbol APOM
Synonyms APOM; apolipoprotein M; ApoM; G3a; NG20; protein G3a; NG20-like protein; alternative name: G3a, NG20; apo-M; HSPC336; MGC22400;
Gene ID 55937
mRNA Refseq NM_001256169
Protein Refseq NP_001243098
MIM 606907
UniProt ID O95445

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All APOM Products

Required fields are marked with *

My Review for All APOM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon