Recombinant Human APOD Protein, His-tagged

• Cat.No.: APOD-192H
• Product Overview: Recombinant Human APOD fused with His tag at C-terminal was expressed in HEK293 cells.

Specification

• Description: THis gene encodes a component of high density lipoprotein that has no marked similarity to other apolipoprotein sequences. It has a high degree of homology to plasma retinol-binding protein and other members of the alpha 2 microglobulin protein superfamily of carrier proteins, also known as lipocalins. THis glycoprotein is closely associated with the enzyme lecithin:cholesterol acyltransferase - an enzyme involved in lipoprotein metabolism.
• Source: HEK293 cells
• Tag: His
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
• Molecular Mass: 20.34kD
• AA Sequence: QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLSVDHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: APOD apolipoprotein D [ Homo sapiens ]
• Official Symbol: APOD
• Synonyms: APOD; apolipoprotein D; apo-D
• Gene ID: 347
• mRNA Refseq: NM_001647
• Protein Refseq: NP_001638
• MIM: 107740
• UniProt ID: P05090