Recombinant Human APOBEC2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : APOBEC2-2366H
Product Overview : APOBEC2 MS Standard C13 and N15-labeled recombinant protein (NP_006780) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Probable C to U editing enzyme whose physiological substrate is not yet known. Does not display detectable apoB mRNA editing. Has a low intrinsic cytidine deaminase activity. May play a role in the epigenetic regulation of gene expression through the process of active DNA demethylation.
Molecular Mass : 25.5 kDa
AA Sequence : MAQKEEAAVATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRNVEYSSGRNKTFLCYVVEAQGKGGQVQASRGYLEDEHAAAHAEEAFFNTILPAFDPALRYNVTWYVSSSPCAACADRIIKTLSKTKNLRLLILVGRLFMWEEPEIQAALKKLKEAGCKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADILKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name APOBEC2 apolipoprotein B mRNA editing enzyme catalytic subunit 2 [ Homo sapiens (human) ]
Official Symbol APOBEC2
Synonyms APOBEC2; apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2; probable C->U-editing enzyme APOBEC-2; ARCD1; ARP1; probable C-> U-editing enzyme APOBEC-2; apolipoprotein B mRNA editing enzyme, catalytic polypeptide 2;
Gene ID 10930
mRNA Refseq NM_006789
Protein Refseq NP_006780
MIM 604797
UniProt ID Q9Y235

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All APOBEC2 Products

Required fields are marked with *

My Review for All APOBEC2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon