Recombinant Human APBB1IP Protein, His-tagged
Cat.No. : | APBB1IP-01H |
Product Overview : | Recombinant Human APBB1IP Protein with His tag was expressed in E. coli. |
Availability | April 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-89 aa |
Description : | Predicted to be involved in signal transduction. Predicted to act upstream of or within T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell and positive regulation of cell adhesion. Located in cytosol and plasma membrane. |
Tag : | C-His |
Molecular Mass : | 11 kDa |
AA Sequence : | MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESHHHHHHHH |
Endotoxin : | < 1 EU/μg of protein determined by LAL method |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.56 mg/mL by BCA |
Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol |
Gene Name | APBB1IP amyloid beta precursor protein binding family B member 1 interacting protein [ Homo sapiens (human) ] |
Official Symbol | APBB1IP |
Synonyms | APBB1IP; amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein; amyloid beta A4 precursor protein-binding family B member 1-interacting protein; INAG1; Rap1 GTP interacting adaptor molecule; RIAM; PREL-1; RARP-1; proline-rich protein 73; proline rich EVH1 ligand 1; proline-rich EVH1 ligand 1; APBB1-interacting protein 1; Rap1-interacting adaptor molecule; Rap1-GTP-interacting adaptor molecule; rap1-GTP-interacting adapter molecule; retinoic acid-responsive proline-rich protein 1; PREL1; RARP1 |
Gene ID | 54518 |
mRNA Refseq | NM_019043 |
Protein Refseq | NP_061916 |
MIM | 609036 |
UniProt ID | Q7Z5R6 |
◆ Recombinant Proteins | ||
Apbb1ip-1656M | Recombinant Mouse Apbb1ip Protein, Myc/DDK-tagged | +Inquiry |
APBB1IP-352H | Recombinant Human APBB1IP Protein, His (Fc)-Avi-tagged | +Inquiry |
APBB1IP-2315H | Recombinant Human APBB1IP Protein, MYC/DDK-tagged | +Inquiry |
APBB1IP-1420H | Recombinant Human APBB1IP protein, His & GST-tagged | +Inquiry |
APBB1IP-10906Z | Recombinant Zebrafish APBB1IP | +Inquiry |
◆ Cell & Tissue Lysates | ||
APBB1IP-29HCL | Recombinant Human APBB1IP lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APBB1IP Products
Required fields are marked with *
My Review for All APBB1IP Products
Required fields are marked with *
0
Inquiry Basket