Recombinant Human APBB1IP Protein, His-tagged

• Cat.No.: APBB1IP-01H
• Product Overview: Recombinant Human APBB1IP Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 2-89 aa
• Description: Predicted to be involved in signal transduction. Predicted to act upstream of or within T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell and positive regulation of cell adhesion. Located in cytosol and plasma membrane.
• Tag: C-His
• Molecular Mass: 11 kDa
• AA Sequence: MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESHHHHHHHH
• Endotoxin: < 1 EU/μg of protein determined by LAL method
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.56 mg/mL by BCA
• Storage Buffer: Sterile PBS, pH7.4, 10% Glycerol

Gene Information

• Gene Name: APBB1IP amyloid beta precursor protein binding family B member 1 interacting protein [ Homo sapiens (human) ]
• Official Symbol: APBB1IP
• Synonyms: APBB1IP; amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein; amyloid beta A4 precursor protein-binding family B member 1-interacting protein; INAG1; Rap1 GTP interacting adaptor molecule; RIAM; PREL-1; RARP-1; proline-rich protein 73; proline rich EVH1 ligand 1; proline-rich EVH1 ligand 1; APBB1-interacting protein 1; Rap1-interacting adaptor molecule; Rap1-GTP-interacting adaptor molecule; rap1-GTP-interacting adapter molecule; retinoic acid-responsive proline-rich protein 1; PREL1; RARP1
• Gene ID: 54518
• mRNA Refseq: NM_019043
• Protein Refseq: NP_061916
• MIM: 609036
• UniProt ID: Q7Z5R6