Recombinant Human AP4M1 protein, GST-tagged

• Cat.No.: AP4M1-663H
• Product Overview: Human AP4M1 full-length ORF ( AAH18705, 1 a.a. - 453 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a subunit of the heterotetrameric AP-4 complex. The encoded protein belongs to the adaptor complexes medium subunits family. This AP-4 complex is involved in the recognition and sorting of cargo proteins with tyrosine-based motifs from the trans-golgi network to the endosomal-lysosomal system. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 75.57 kDa
• AA Sequence: MISQFFILSSKGDPLIYKDFRGDSGGRDVAELFYRKLTGLPGDESPVVMHHHGRHFIHIRHSGLYLVVTTSENVSPFSLLELLSRLATLLGDYCGSLGEGTISRNVALVYELLDEVLDYGYVQTTSTEMLRNFIQTEAVVSKPFSLFDLSSVGLFGAETQQSKVAPSSAASRPVLSSRSDQSQKNEVFLDVVERLSVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFESHRILRLQPPQGELTVMRYQLSDDLPSPLPFRLFPSVQWDRGSGRLQVYLKLRCDLLSKSQALNVRLHLPLPRGVVSLSQELSSPEQKAELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLSTSASPLGLGPASLSFELPRHTCSGLQVRFLRLAFRPCGNANPHKWVRHLSHSDAYVIRI
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AP4M1 adaptor-related protein complex 4, mu 1 subunit [ Homo sapiens ]
• Official Symbol: AP4M1
• Synonyms: AP4M1; adaptor-related protein complex 4, mu 1 subunit; AP-4 complex subunit mu-1; adaptor related protein complex AP 4 mu4 subunit; AP 4 adapter complex mu subunit; mu subunit of AP 4; MU 4; mu adaptin related protein 2; MU ARP2; mu4; mu4-adaptin; mu subunit of AP-4; mu-adaptin-related protein 2; mu-adaptin-related protein-2; adapter-related protein complex 4 mu-1 subunit; adaptor-related protein complex AP-4 mu4 subunit; MU-4; CPSQ3; MU-ARP2
• Gene ID: 9179
• mRNA Refseq: NM_004722
• Protein Refseq: NP_004713
• MIM: 602296
• UniProt ID: O00189