Recombinant Human AP3S2 protein, GST-tagged

• Cat.No.: AP3S2-660H
• Product Overview: Human AP3S2 full-length ORF ( NP_005820.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: AP3S2 (Adaptor Related Protein Complex 3 Sigma 2 Subunit) is a Protein Coding gene. Among its related pathways are Lysosome. GO annotations related to this gene include protein transporter activity. An important paralog of this gene is AP3S1.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 48.4 kDa
• AA Sequence: MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AP3S2 adaptor-related protein complex 3, sigma 2 subunit [ Homo sapiens ]
• Official Symbol: AP3S2
• Synonyms: AP3S2; adaptor-related protein complex 3, sigma 2 subunit; AP-3 complex subunit sigma-2; sigma3b; sigma-3B-adaptin; sigma-adaptin 3b; adaptor complex sigma3B; AP-3 complex subunit sigma-3B; clathrin-associated/assembly/adaptor protein, small 4, 22-kD; AP3S3; FLJ35955
• Gene ID: 10239
• mRNA Refseq: NM_005829
• Protein Refseq: NP_005820
• MIM: 602416
• UniProt ID: P59780