Recombinant Human AP3S1 protein, GST-tagged

• Cat.No.: AP3S1-659H
• Product Overview: Human AP3S1 full-length ORF ( AAH00804.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a subunit of the AP3 adaptor complex. This complex functions in the formation of subcellular vesicles budded from the Golgi body. Several related pseudogenes of this gene have been found. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 46.86 kDa
• AA Sequence: MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLEGGLLIGGSDNKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHVDKVHNILAEMVMGGMVLETNMNEIVTQIDAQNKLEKSEAGLAGAPARAVSAVKNMNLPEIPRNINIGDISIKVPNLPSFK
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AP3S1 adaptor-related protein complex 3, sigma 1 subunit [ Homo sapiens ]
• Official Symbol: AP3S1
• Synonyms: AP3S1; adaptor-related protein complex 3, sigma 1 subunit; CLAPS3; AP-3 complex subunit sigma-1; sigma3A-adaptin; sigma-3A-adaptin; sigma-adaptin 3a; AP-3 complex sigma-3A subunit; AP-3 complex subunit sigma-3A; adapter-related protein complex 3 sigma-1 subunit; clathrin-associated/assembly/adapter protein, small 3; clathrin-associated/assembly/adaptor protein, small 3 (22kD); Sigma3A
• Gene ID: 1176
• mRNA Refseq: NM_001284
• Protein Refseq: NP_001275
• MIM: 601507
• UniProt ID: Q92572