Recombinant Human AP1S1 protein, GST-tagged

• Cat.No.: AP1S1-8271H
• Product Overview: Recombinant Human AP1S1 protein(1-127 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: GST
• Protein Length: 1-127 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: AP1S1
• Synonyms: AP1S1; adaptor-related protein complex 1, sigma 1 subunit; CLAPS1; AP-1 complex subunit sigma-1A; AP 1 complex subunit sigma 1A; AP19; clathrin assembly protein complex 1 sigma 1A small chain; clathrin coat assembly protein AP19; clathrin associated/assembly/adaptor protein; small 1 (19kD); golgi adaptor HA1/AP1 adaptin sigma 1A subunit; HA1 19 kDa subunit; SIGMA1A; sigma1A subunit of AP 1 clathrin adaptor complex; sigma1A adaptin; WUGSC:H_DJ0747G18.2; sigma1A-adaptin; sigma-adaptin 1A; sigma 1a subunit of AP-1 clathrin; adaptor protein complex AP-1 sigma-1A subunit; golgi adaptor HA1/AP1 adaptin sigma-1A subunit; sigma1A subunit of AP-1 clathrin adaptor complex; adapter-related protein complex 1 sigma-1A subunit; clathrin assembly protein complex 1 sigma-1A small chain; clathrin-associated/assembly/adaptor protein, small 1 (19kD); FLJ92436
• Gene ID: 1174
• mRNA Refseq: NM_001283
• Protein Refseq: NP_001274
• MIM: 603531
• UniProt ID: P61966