Recombinant Human ANTXR2 protein, His-tagged

Cat.No. : ANTXR2-3736H
Product Overview : Recombinant Human ANTXR2 protein(25-231 aa), fused to His tag, was expressed in E. coli.
Availability February 08, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
ProteinLength : 25-231 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : ISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQSCTEILELQPSSVCVGEEFQIVLSGRGFMLGSRNGSVLCTYTVNETYTTSVKPVSVQLNSMLCPAPILNKAGETLDVSVSFNGGKSVISGSL
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name ANTXR2 anthrax toxin receptor 2 [ Homo sapiens ]
Official Symbol ANTXR2
Synonyms ANTXR2; anthrax toxin receptor 2; capillary morphogenesis protein 2; CMG 2; CMG2; FLJ31074; capillary morphogenesis gene 2 protein; ISH; JHF; CMG-2; MGC45856; MGC111533;
Gene ID 118429
mRNA Refseq NM_001145794
Protein Refseq NP_001139266
MIM 608041
UniProt ID P58335

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ANTXR2 Products

Required fields are marked with *

My Review for All ANTXR2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon