Recombinant Human ANTXR2 protein, His-tagged

• Cat.No.: ANTXR2-3736H
• Product Overview: Recombinant Human ANTXR2 protein(25-231 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 25-231 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: ISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQSCTEILELQPSSVCVGEEFQIVLSGRGFMLGSRNGSVLCTYTVNETYTTSVKPVSVQLNSMLCPAPILNKAGETLDVSVSFNGGKSVISGSL
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ANTXR2 anthrax toxin receptor 2 [ Homo sapiens ]
• Official Symbol: ANTXR2
• Synonyms: ANTXR2; anthrax toxin receptor 2; capillary morphogenesis protein 2; CMG 2; CMG2; FLJ31074; capillary morphogenesis gene 2 protein; ISH; JHF; CMG-2; MGC45856; MGC111533
• Gene ID: 118429
• mRNA Refseq: NM_001145794
• Protein Refseq: NP_001139266
• MIM: 608041
• UniProt ID: P58335